Hydrogenophaga sp. RAC07: BSY239_2524 Help Entry BSY239_2524       CDS       T04455                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hyr  Hydrogenophaga sp. RAC07 Pathway hyr01100   Metabolic pathways hyr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hyr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BSY239_2524 (acpP)    00074 Mycolic acid biosynthesis     BSY239_2524 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BSY239_2524 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AOF85089 UniProt:  A0A1B3LW60 LinkDB All DBs Position complement(2694000..2694239) Genome browser AA seq 79 aa AA seqDB search MSDIEARVKKIIAEQLGVEEGQVTNEKAFVADLGADSLDTVELVMALEDEFGIEIPDEDA EKITTVQNAIDYAMAHQKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgaagcacgtgttaagaaaatcattgccgaacaactcggtgtggaagag ggtcaagtcaccaacgaaaaagctttcgtggccgacctcggcgctgattccctggacacg gtcgaattggtgatggctctcgaggacgagttcggtatcgaaatccccgacgaagacgcc gagaaaatcacgacggtgcaaaacgccatcgattacgcaatggcccaccagaaggcctga

DBGET integrated database retrieval system