Hydrogenophaga sp. RAC07: BSY239_710 Help Entry BSY239_710        CDS       T04455                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism hyr  Hydrogenophaga sp. RAC07 Brite KEGG Orthology (KO) [BR:hyr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:hyr03036]     BSY239_710    03400 DNA repair and recombination proteins [BR:hyr03400]     BSY239_710 Chromosome and associated proteins [BR:hyr03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     BSY239_710 DNA repair and recombination proteins [BR:hyr03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       BSY239_710 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Histone_HNS_N Cdh1_DBD_1 Motif Other DBs NCBI-ProteinID:  AOF84693 UniProt:  A0A1B3LV07 LinkDB All DBs Position 752413..752718 Genome browser AA seq 101 aa AA seqDB search MASYSELMAQAQTLMAQAEQARKDELASVIADIKAKMKQFGISVADLGGTTGSKKPAKSK SVSAPKYRGPNGELWAGGPGRKPEWVRAVLASGKSVDDYLI NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atggcaagctattccgaactcatggcgcaagcgcaaaccctgatggcccaggccgagcag gcgcgcaaagacgaacttgcttccgtgattgccgacatcaaggccaaaatgaagcaattc ggcatttcggtggccgatctgggcggcacgaccggcagcaaaaaaccggccaaatccaaa tcggtgtcggcgccgaaataccgcggcccgaacggcgaactctgggccggtggtccaggc cgcaaacccgagtgggtgcgcgctgtgttggcgtcgggcaaaagcgttgacgactacctg atctga

DBGET integrated database retrieval system