Hydrogenophaga sp. RAC07: BSY239_893 Help Entry BSY239_893        CDS       T04455                                  Name (GenBank) exonuclease VII small subunit   KO K03602   exodeoxyribonuclease VII small subunit [EC:3.1.11.6] Organism hyr  Hydrogenophaga sp. RAC07 Pathway hyr03430   Mismatch repair Brite KEGG Orthology (KO) [BR:hyr00001]  09120 Genetic Information Processing   09124 Replication and repair    03430 Mismatch repair     BSY239_893  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:hyr03400]     BSY239_893 Enzymes [BR:hyr01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters     3.1.11.6  exodeoxyribonuclease VII      BSY239_893 DNA repair and recombination proteins [BR:hyr03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA exonucleases      BSY239_893 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Exonuc_VII_S PI3K_P85_iSH2 Motif Other DBs NCBI-ProteinID:  AOF87059 UniProt:  A0A1B3M1R6 LinkDB All DBs Position 953445..953813 Genome browser AA seq 122 aa AA seqDB search MERGEFYPRGQYPLPSAGMQKRAHFRMNHVNEPMPTVPRTPKTSPSASAADTQPVAASYE AALEELEQLVSQLDAGQLPLDQLLTRYQRGAELLAFCRARLEAVENQIKVLEGGELKSWD QP NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atggaaaggggcgaattctacccccgggggcagtacccgttgcccagcgccggtatgcaa aagcgtgcccactttagaatgaaccacgtgaacgaacccatgcccaccgtgccccgcact cccaagacatccccttccgcatccgcagccgatacgcagcccgtcgcggccagctacgag gccgcgctcgaagagctggaacagctcgtctcgcaactcgatgccggccagctgccgctg gaccagttgctcacgcgttaccagcgcggtgccgagctgctcgctttctgtcgcgctcgt ctggaagcggtggaaaaccagatcaaggtgcttgagggcggcgagctcaagtcctgggac cagccatga

DBGET integrated database retrieval system