Helicoverpa zea (corn earworm): 124634396 Help Entry 124634396         CDS       T08400                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism hze  Helicoverpa zea (corn earworm) Pathway hze04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:hze00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     124634396  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:hze04121]     124634396    03400 DNA repair and recombination proteins [BR:hze03400]     124634396 Ubiquitin system [BR:hze04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      124634396    Cul5 complex      124634396 DNA repair and recombination proteins [BR:hze03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      124634396 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  124634396 NCBI-ProteinID:  XP_047025921 LinkDB All DBs Position 11:11193467..11199607 Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRKKLTIFTDAKDTTTVLELKKMIEGILKVTPQSQMLFNKDSQLMEDEKTLAE YGLTSATAKAQCPAPIGLALRKENGEFEALDLTPYSSPPDLPDVMKSQETNGQEQMDQH NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggatgtctttctaatgattaggcgaaaaaaattaaccatcttcaccgacgcgaaggac acgacaactgtgctagaattgaagaaaatgatcgaaggtatcctgaaagtgaccccacaa agtcagatgctgttcaataaggacagccagctgatggaggatgagaagaccctcgctgag tacgggctaacatccgctactgctaaggcccagtgtcccgcacctattggattggcttta aggaaggaaaatggcgagtttgaagccttggacctgactccgtactcttcgccgcccgac ttgcctgacgtgatgaaatcacaggagaccaacggacaagaacaaatggatcaacactag

DBGET integrated database retrieval system