Helicoverpa zea (corn earworm): 124645540 Help Entry 124645540         CDS       T08400                                  Name (RefSeq) eclosion hormone   KO K28249   eclosion hormone Organism hze  Helicoverpa zea (corn earworm) Brite KEGG Orthology (KO) [BR:hze00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hze04052]     124645540 Cytokines and neuropeptides [BR:hze04052]  Neuropeptides   Unclassified    124645540 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Eclosion Motif Other DBs NCBI-GeneID:  124645540 NCBI-ProteinID:  XP_047041307 LinkDB All DBs Position Unknown AA seq 88 aa AA seqDB search MAGKITAVFIVFVTIAFLANFGHVVCNPAIATGYDPMEVCIENCAQCKKMLGAWFEGPLC AESCITFKGKLIPECENFASISPFLNKL NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atggccggcaagatcaccgctgttttcatcgtcttcgtcaccattgcattcctcgccaac ttcggccatgtcgtctgcaaccctgctatcgcaactggctacgatcccatggaggtttgc atcgagaactgcgcacaatgcaagaaaatgctcggcgcatggttcgaaggccccctctgc gcagaatcctgcatcaccttcaaaggaaagctgatccccgaatgcgaaaacttcgcgtcc atctcgcctttcctaaacaaactttaa

DBGET integrated database retrieval system