KEGG   Idiomarina abyssalis: K5X84_02525
Entry
K5X84_02525       CDS       T07548                                 
Name
(GenBank) acylneuraminate cytidylyltransferase family protein
  KO
K24307  5-N-acetyl-7-N-(D-alanyl)-legionaminic acid cytidylyltransferase
Organism
iab  Idiomarina abyssalis
Pathway
iab00541  O-Antigen nucleotide sugar biosynthesis
iab01100  Metabolic pathways
iab01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:iab00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    K5X84_02525
SSDB
Motif
Pfam: CTP_transf_3 IspD NTP_transf_3
Other DBs
NCBI-ProteinID: QZN91416
LinkDB
Position
511868..512578
AA seq 236 aa
MNDMNSSETLIIIPARGGSKRLPRKNVKPLAGKPLICWTIEAAIKAKLDAKIIVTSDDDE
ILGLADAYKSKGVYKRKRPDNLATDTASTVDAITDVIESEKELGNNPQTIILLQPTSPLR
NEDDIRNAFLLYNDTEAHNYRNTVVSVCEVEHPTAWVGRVDESMSFTGTELLNKRSQDYE
KEYRLNGAVYVASVGCIMRQKSLFSPELKASIMPRMRSMDIDEEIDFKVCEGLLGG
NT seq 711 nt   +upstreamnt  +downstreamnt
ttgaatgacatgaatagttcagaaactcttataattatacctgcaagaggcggaagtaaa
cgccttccaagaaagaacgttaagccgttagcgggtaagcctcttatttgttggacaata
gaagccgcaataaaagccaaattagatgcgaaaataatcgtgaccagcgacgatgatgaa
atacttggactggctgatgcatacaaaagtaaaggggtttacaagcgcaagcggcctgac
aatttagcaacggatacagcaagtacagtcgacgcaataacagatgttattgagtctgaa
aaagagttaggtaataacccacaaacaattattctgctgcagcctacttcgccgcttcga
aacgaagatgatattcgcaatgcgtttcttttgtataacgatacagaagctcataattac
agaaatactgtggttagcgtttgtgaagtggagcatccaactgcctgggttgggcgggtt
gatgaaagtatgtcatttacaggcacggaactgttgaataaacgctctcaagactacgaa
aaagaataccggcttaacggggcggtttatgtggcttctgttgggtgtattatgaggcaa
aaatctctattctctcccgagctgaaagcatcaataatgccgagaatgcgttctatggat
attgatgaagagattgattttaaagtttgtgaggggttactcggtggttga

DBGET integrated database retrieval system