Ignisphaera aggregans: Igag_1101 Help Entry Igag_1101         CDS       T01307                                  Name (GenBank) SSU ribosomal protein S27AE   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism iag  Ignisphaera aggregans Pathway iag03010   Ribosome Brite KEGG Orthology (KO) [BR:iag00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     Igag_1101   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     Igag_1101  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:iag03011]     Igag_1101    04121 Ubiquitin system [BR:iag04121]     Igag_1101   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:iag04147]     Igag_1101 Ribosome [BR:iag03011]  Ribosomal proteins   Eukaryotes    Small subunit     Igag_1101   Archaea     Igag_1101 Ubiquitin system [BR:iag04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    Igag_1101 Exosome [BR:iag04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    Igag_1101   Exosomal proteins of colorectal cancer cells    Igag_1101 SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_S27 Zn_ribbon_IS1595 IBR_1 DUF7479 DUF7838 Zn_ribbon_SprT RNHCP Zn_ribbon_PriA Ribosomal_L37ae Cas12f1-like_TNB GFA Zn_ribbon_NUD Zn_ribbon_recom Zn_ribbon_Nudix Zn_ribbon_RPB9 Lar_restr_allev YPEH2ZP DUF8512 Zn_Ribbon_TF CHAMP1_N Zn_ribbon_ISL3 Auto_anti-p27 zf-C2H2_CASZ1 Motif Other DBs NCBI-ProteinID:  ADM27914 UniProt:  E0SNW8 LinkDB All DBs Position complement(1033657..1033845) Genome browser AA seq 62 aa AA seqDB search MGEKIFRSRLYEYDYSKGTIKLKNRLCPRCGSVMAYHRVGKPRWHCGKCNYTIFVEEKPS AK NT seq 189 nt NT seq  +upstreamnt  +downstreamnt atgggtgaaaagatctttagatcaagactatatgaatatgactatagtaagggtactata aagctgaagaatagactttgcccacgctgtggctctgtaatggcttatcatagagttggt aaacctagatggcattgtggaaagtgtaactatacaatatttgttgaggagaagccttca gcgaaatag

DBGET integrated database retrieval system