Intestinimonas butyriciproducens: IB211_01911 Help Entry IB211_01911       CDS       T04182                                  Name (GenBank) D-binding protein HBsu   KO K03530   DNA-binding protein HU-beta Organism ibu  Intestinimonas butyriciproducens Brite KEGG Orthology (KO) [BR:ibu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:ibu03032]     IB211_01911    03036 Chromosome and associated proteins [BR:ibu03036]     IB211_01911    03400 DNA repair and recombination proteins [BR:ibu03400]     IB211_01911 DNA replication proteins [BR:ibu03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     IB211_01911 Chromosome and associated proteins [BR:ibu03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     IB211_01911 DNA repair and recombination proteins [BR:ibu03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       IB211_01911 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG DUF2530 HU-CCDC81_bac_2 Motif Other DBs NCBI-ProteinID:  ALP94302 UniProt:  A0A0S2W4P6 LinkDB All DBs Position 1902061..1902333 Genome browser AA seq 90 aa AA seqDB search MNKQDLIRKIADGAGIAQKDAAAALDSTLDAIVAAVVAGEKVQLVGFGTFEVKKRSARVG RNPATNAVIEIPESTVPVFKAGKAFKDAVK NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaataagcaagacttaatccgcaagatcgccgacggtgcaggcatcgctcagaaggat gccgcggccgctctcgacagtaccctggacgctattgttgccgctgttgttgccggagaa aaggtgcaattggtcggctttggaacctttgaggtcaaaaagcgcagcgcaagagttggc cgcaaccccgctaccaatgcggtcatcgagattcctgaatccacggtgccagtatttaag gccggcaaggcatttaaggacgctgttaagtaa

DBGET integrated database retrieval system