Intestinimonas butyriciproducens: IB211_02196c Help Entry IB211_02196c      CDS       T04182                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism ibu  Intestinimonas butyriciproducens Pathway ibu01100   Metabolic pathways ibu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ibu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     IB211_02196c    00074 Mycolic acid biosynthesis     IB211_02196c   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     IB211_02196c BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  ALP94587 UniProt:  A0A0S2W5L0 LinkDB All DBs Position complement(2169276..2169512) Genome browser AA seq 78 aa AA seqDB search MIFEKLSELISEQFGVEPDTITMETTFEDDLGADSLDIVELSMALEEEFGVSEMGEDEIS SITTVGDLVHYLQNKLDA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgatttttgagaagctgagtgaactcatttcggagcagtttggggtggagccggacacg atcacgatggagaccacctttgaggatgatctgggcgcggattctctggatatcgtggag ctctccatggccctggaggaggagttcggcgtttctgagatgggagaggatgagatatcc tccatcaccacggtgggcgacttggtgcactatctccagaacaagctggacgcctga

DBGET integrated database retrieval system