Ideonella dechloratans: LRM40_05435 Help Entry LRM40_05435       CDS       T07737                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism idc  Ideonella dechloratans Pathway idc01100   Metabolic pathways idc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:idc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LRM40_05435 (acpP)    00074 Mycolic acid biosynthesis     LRM40_05435 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LRM40_05435 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 DUF1896 Motif Other DBs NCBI-ProteinID:  UFU11116 LinkDB All DBs Position 1159732..1159971 Genome browser AA seq 79 aa AA seqDB search MSDIEARVKKIIAEQLGVPEADVTNEKAFVADLGADSLDTVELVMALEDEFGIEIPDEEA EKITTVQLAIDYAKAHAKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgaagcacgcgtcaagaagatcattgccgagcagctgggtgttcccgaa gccgacgtcaccaacgaaaaggcctttgtggccgacctgggcgccgattccctggacacc gtcgagctggtgatggccctcgaggacgagttcggcatcgaaatccccgatgaggaagcc gaaaagatcacgaccgtgcagctggcgatcgactacgccaaggcccacgccaaggcctga

DBGET integrated database retrieval system