Isoptericola dokdonensis: I598_0289 Help Entry I598_0289         CDS       T04384                                  Symbol acpP Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism ido  Isoptericola dokdonensis Pathway ido01100   Metabolic pathways ido01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ido00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     I598_0289 (acpP)    00074 Mycolic acid biosynthesis     I598_0289 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     I598_0289 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 PP-binding_2 Motif Other DBs NCBI-ProteinID:  ANC29878 UniProt:  A0A168ECH5 LinkDB All DBs Position complement(315131..315379) Genome browser AA seq 82 aa AA seqDB search MAYTASEILEGLAEIVAEETGLPTDAVASEKSFTDDLDIDSLSMMTIVTHAEDKFGVRIP DDEVKNLTTVGDAVSFIEGAQA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggcttacaccgcatccgagatcctcgagggcctcgccgagatcgtcgccgaggagacc ggcctgcccaccgacgccgtcgcgtcggagaagtccttcaccgacgacctcgacatcgac tcgctgtcgatgatgacgatcgtcacccacgccgaggacaagttcggcgtccgcatcccg gacgacgaggtcaagaacctcaccaccgtcggcgacgccgtctccttcatcgagggcgcc caggcctga

DBGET integrated database retrieval system