Idiomarina sp. PL1-037: U0358_01905
Help
Entry
U0358_01905 CDS
T10248
Symbol
ssb
Name
(GenBank) single-stranded DNA-binding protein
KO
K03111
single-strand DNA-binding protein
Organism
idp Idiomarina sp. PL1-037
Pathway
idp03030
DNA replication
idp03430
Mismatch repair
idp03440
Homologous recombination
Brite
KEGG Orthology (KO) [BR:
idp00001
]
09120 Genetic Information Processing
09124 Replication and repair
03030 DNA replication
U0358_01905 (ssb)
03430 Mismatch repair
U0358_01905 (ssb)
03440 Homologous recombination
U0358_01905 (ssb)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03032 DNA replication proteins [BR:
idp03032
]
U0358_01905 (ssb)
03400 DNA repair and recombination proteins [BR:
idp03400
]
U0358_01905 (ssb)
03029 Mitochondrial biogenesis [BR:
idp03029
]
U0358_01905 (ssb)
DNA replication proteins [BR:
idp03032
]
Prokaryotic type
DNA Replication Initiation Factors
Initiation factors (bacterial)
U0358_01905 (ssb)
DNA repair and recombination proteins [BR:
idp03400
]
Prokaryotic type
SSBR (single strand breaks repair)
MMR (mismatch excision repair)
Other MMR factors
U0358_01905 (ssb)
TLS (translesion DNA synthesis) factors
Other SOS response factors
U0358_01905 (ssb)
Mitochondrial biogenesis [BR:
idp03029
]
Mitochondrial DNA transcription, translation, and replication factors
Mitochondrial DNA replication factors
Other Mitochondrial DNA replication factors
U0358_01905 (ssb)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
SSB
Lyase_8_N
TFIIA
tRNA_anti-codon
Motif
Other DBs
NCBI-ProteinID:
WQC53332
LinkDB
All DBs
Position
402041..402601
Genome browser
AA seq
186 aa
AA seq
DB search
MASRGVNKVILIGNLGADPEVRYTQNSTAIANLSIATSETWKDKQTGEPREQTEWHRCVA
YRRLAEIAGEYLKKGSKVYVEGRLQTRKWTGQDNVERYTTEVVINEMQMLDSRGGPQGGA
PQQGQGFGGGQQQGGGYGGGQPQQQSQQQQRPAPQPAQQQNQQSQQKPAEPAPFSPDNDF
DDDIPF
NT seq
561 nt
NT seq
+upstream
nt +downstream
nt
atggccagtcgcggtgtaaataaagtaattttaattggtaatttgggtgctgatccagag
gttcgttatacccaaaacagcacagcgatagccaacctgtcgattgcgaccagtgaaacc
tggaaagataagcaaacaggcgaaccgcgcgaacagaccgaatggcaccgttgtgtggct
tatcgtcgcttagcagaaattgccggcgagtacctgaaaaagggctctaaagtttatgtt
gaagggcgtttgcaaacccgtaaatggacaggccaggacaacgtagagcgttacacgaca
gaagtggtcattaacgaaatgcaaatgctggattctcgtggcggtcctcagggtggtgct
ccacaacaaggccagggttttggtggcggtcagcagcaaggcggtggttacggtggtggt
caaccacaacagcaatcacagcaacaacagcgccctgcacctcagccagcgcagcagcaa
aatcaacagtcacaacaaaaaccggcagaacccgcgccgttttcacctgacaacgatttt
gatgacgacattcccttctaa
DBGET
integrated database retrieval system