Idiomarina sp. OT37-5b: C5610_06435 Help Entry C5610_06435       CDS       T05379                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism idt  Idiomarina sp. OT37-5b Pathway idt01100   Metabolic pathways idt01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:idt00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     C5610_06435    00074 Mycolic acid biosynthesis     C5610_06435   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     C5610_06435 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 DUF1493 Motif Other DBs NCBI-ProteinID:  AVJ55979 LinkDB All DBs Position complement(1382670..1382909) Genome browser AA seq 79 aa AA seqDB search MSTIEERVKKIIVEQLGVKEEEVKPEASFENDLGADSLDTVELVMALEEEFETEIPDEEA EKIKTVQAAIDYVSAHSDD NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcactattgaagaacgcgtaaaaaaaatcatcgttgaacaactgggcgttaaagaa gaagaagtaaagcctgaagcttcattcgaaaacgatctgggtgctgactctcttgacacc gttgagctggtaatggctctggaagaagagttcgaaactgagattcctgatgaagaagca gagaaaatcaaaaccgttcaagcggctatcgattacgtgtctgctcattcagacgactaa

DBGET integrated database retrieval system