Ictalurus furcatus (blue catfish): 128599437 Help Entry 128599437         CDS       T09387                                  Name (RefSeq) cystatin-B   KO K13907   cystatin-A/B Organism ifu  Ictalurus furcatus (blue catfish) Brite KEGG Orthology (KO) [BR:ifu00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:ifu01002]     128599437   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ifu04147]     128599437 Peptidases and inhibitors [BR:ifu01002]  Peptidase inhibitors   Family I25: cystatin family    128599437 Exosome [BR:ifu04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    128599437 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cystatin Dynein_light Motif Other DBs NCBI-GeneID:  128599437 NCBI-ProteinID:  XP_053466954 LinkDB All DBs Position 23:complement(5531640..5535381) Genome browser AA seq 100 aa AA seqDB search MSLLCGGTSEEQDATDEVQKICDEVKPHAEEKAGKTFDVFTAKSYKSQLVAGTNYFIKVH VGGDDFVHLRVYKMLPHAGEKLELHGIQTSKAHHDPIEYF NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgtcactgttgtgcggagggactagcgaggagcaggacgccactgatgaagtgcagaaa atctgtgatgaggtgaagcctcatgcggaggaaaaagctggaaaaacgtttgacgtcttc actgctaaatcctacaagtcacagctggtagctgggacaaactatttcatcaaggtccac gtgggtggcgatgactttgttcacctgcgggtctataagatgctgccacacgctggagaa aaactggaacttcatggaattcagacaagcaaagcccatcatgaccccatcgaatacttc taa

DBGET integrated database retrieval system