Ictalurus furcatus (blue catfish): 128602583 Help Entry 128602583         CDS       T09387                                  Name (RefSeq) histone H2B.1, sperm-like   KO K11252   histone H2B Organism ifu  Ictalurus furcatus (blue catfish) Brite KEGG Orthology (KO) [BR:ifu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ifu03036]     128602583   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ifu04147]     128602583 Chromosome and associated proteins [BR:ifu03036]  Eukaryotic type   Nucleosome assembly factors    Histones     128602583 Exosome [BR:ifu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    128602583 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-GeneID:  128602583 NCBI-ProteinID:  XP_053472443 LinkDB All DBs Position 27:1248721..1249317 Genome browser AA seq 97 aa AA seqDB search MKAVRSKRKSRAAHPRAKAHLRAHAVYIYKLRRELEPVHCRLVGDSRLAASFHLRRVGLE AARLTISNRRGIITSREISAAMQQLSHRRNTIPMDGA NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgaaagcagtccgctcgaagaggaagtcacgcgccgctcatccgagagcaaaggcccat ctccgcgcgcacgcggtctacatttataaactacgcagagagctcgagcctgttcactgc agattggtgggggattcgaggctcgcggcgtcgtttcatttaagaagagtaggcctggag gccgcgcgcttgactatttctaaccggcgcgggatcatcacgagccgggagatcagtgcg gccatgcagcagctctcacaccgccgcaataccatccctatggacggagcatga

DBGET integrated database retrieval system