Ictalurus furcatus (blue catfish): 128602959 Help Entry 128602959         CDS       T09387                                  Symbol hrasb Name (RefSeq) HRas proto-oncogene, GTPase b   KO K02833   GTPase HRas Organism ifu  Ictalurus furcatus (blue catfish) Pathway ifu04010   MAPK signaling pathway ifu04012   ErbB signaling pathway ifu04068   FoxO signaling pathway ifu04137   Mitophagy - animal ifu04140   Autophagy - animal ifu04144   Endocytosis ifu04150   mTOR signaling pathway ifu04210   Apoptosis ifu04218   Cellular senescence ifu04370   VEGF signaling pathway ifu04371   Apelin signaling pathway ifu04510   Focal adhesion ifu04540   Gap junction ifu04625   C-type lectin receptor signaling pathway ifu04810   Regulation of actin cytoskeleton ifu04910   Insulin signaling pathway ifu04912   GnRH signaling pathway ifu04916   Melanogenesis ifu05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ifu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     128602959 (hrasb)    04012 ErbB signaling pathway     128602959 (hrasb)    04370 VEGF signaling pathway     128602959 (hrasb)    04371 Apelin signaling pathway     128602959 (hrasb)    04068 FoxO signaling pathway     128602959 (hrasb)    04150 mTOR signaling pathway     128602959 (hrasb)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     128602959 (hrasb)    04140 Autophagy - animal     128602959 (hrasb)    04137 Mitophagy - animal     128602959 (hrasb)   09143 Cell growth and death    04210 Apoptosis     128602959 (hrasb)    04218 Cellular senescence     128602959 (hrasb)   09144 Cellular community - eukaryotes    04510 Focal adhesion     128602959 (hrasb)    04540 Gap junction     128602959 (hrasb)   09142 Cell motility    04810 Regulation of actin cytoskeleton     128602959 (hrasb)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     128602959 (hrasb)   09152 Endocrine system    04910 Insulin signaling pathway     128602959 (hrasb)    04912 GnRH signaling pathway     128602959 (hrasb)    04916 Melanogenesis     128602959 (hrasb)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     128602959 (hrasb)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ifu04131]     128602959 (hrasb)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ifu04147]     128602959 (hrasb)    04031 GTP-binding proteins [BR:ifu04031]     128602959 (hrasb) Membrane trafficking [BR:ifu04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     128602959 (hrasb)  Endocytosis   Macropinocytosis    Ras GTPases     128602959 (hrasb) Exosome [BR:ifu04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    128602959 (hrasb)   Exosomal proteins of colorectal cancer cells    128602959 (hrasb) GTP-binding proteins [BR:ifu04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     128602959 (hrasb) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 G-alpha Septin DUF6974 Ldh_1_N Motif Other DBs NCBI-GeneID:  128602959 NCBI-ProteinID:  XP_053473099 LinkDB All DBs Position 27:9411892..9421686 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVDTRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDDNGQD CMNCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggagtacaaattggtggtggttggtgctggtggtgtgggcaagagtgcgctcaca attcaactgatccagaaccactttgttgatgagtatgaccctactatagaagactcctac agaaaacaggtggtgattgatggcgagacgtgtctgctggacattctggacaccgctggt caggaggagtacagcgccatgagggaccaatacatgaggacaggagagggattcctctgt gtcttcgccatcaacaacactaagtcctttgaggacatccaccagtacagggaacagatc aaaagggtaaaagattcagatgatgtgcccatggtgcttgtgggtaataaatgtgaccta ccagctcgtacagtggacacaagacaagcccaggaactggctcgcagttatggcatccct tatattgaaacatctgccaagacaagacagggagtggaggacgcgttctacacactggtg cgtgaaatcaggcagcacaagctcagaaagctgaatccaccagacgacaacggccaagac tgcatgaactgccgctgtgtcgtgtcatga

DBGET integrated database retrieval system