Ictalurus furcatus (blue catfish): 128604917 Help Entry 128604917         CDS       T09387                                  Name (RefSeq) histone H2A   KO K11251   histone H2A Organism ifu  Ictalurus furcatus (blue catfish) Pathway ifu03082   ATP-dependent chromatin remodeling ifu04217   Necroptosis Brite KEGG Orthology (KO) [BR:ifu00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     128604917  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     128604917  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ifu03036]     128604917   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ifu04147]     128604917 Chromosome and associated proteins [BR:ifu03036]  Eukaryotic type   Nucleosome assembly factors    Histones     128604917 Exosome [BR:ifu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    128604917 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  128604917 NCBI-ProteinID:  XP_053476015 LinkDB All DBs Position Unknown AA seq 128 aa AA seqDB search MSGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TEKAVKTK NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atgagtggcagaggaaaaaccggcggaaaggctagagctaaggccaagactcgttcatcc agggctggacttcagttccccgtgggacgtgtgcacaggcttctgcgtaaaggcaactat gccgagcgcgtcggtgccggcgctccggtctacctggccgcagtgttggagtatctgacc gctgagatcctggagttggccggtaacgccgcccgtgacaacaagaagacccgtatcatt ccccgccacttgcagctcgccgtgcgtaacgacgaggagctgaacaaactgctcggcgga gtgaccatcgctcagggtggtgtgctgccaaacattcaggctgtgcttctgcccaaaaag actgagaaggccgttaagaccaagtaa

DBGET integrated database retrieval system