Ictalurus furcatus (blue catfish): 128606668 Help Entry 128606668         CDS       T09387                                  Symbol mt2 Name (RefSeq) metallothionein-2   KO K14739   metallothionein 1/2 Organism ifu  Ictalurus furcatus (blue catfish) Brite KEGG Orthology (KO) [BR:ifu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:ifu03019]     128606668 (mt2)    03029 Mitochondrial biogenesis [BR:ifu03029]     128606668 (mt2) Messenger RNA biogenesis [BR:ifu03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      128606668 (mt2) Mitochondrial biogenesis [BR:ifu03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     128606668 (mt2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  128606668 NCBI-ProteinID:  XP_053478965 LinkDB All DBs Position 4:12051243..12052068 Genome browser AA seq 60 aa AA seqDB search MDPCECSKTGTCNCGTSCKCSNCQCACCKKSCCSCCPSGCSKCASGCVCKGDTCDSKCCQ NT seq 183 nt NT seq  +upstreamnt  +downstreamnt atggatccctgcgagtgctccaagactggaacctgcaactgcggtacatcctgtaaatgc tcaaactgccagtgtgcatgctgcaagaaaagctgctgctcttgctgcccttctggctgc agtaagtgtgcgtctggatgcgtgtgcaagggtgatacctgcgattccaagtgctgccag tga

DBGET integrated database retrieval system