Ictalurus furcatus (blue catfish): 128606997 Help Entry 128606997         CDS       T09387                                  Symbol s100a10b Name (RefSeq) protein S100-A10b   KO K17274   protein S100-A10 Organism ifu  Ictalurus furcatus (blue catfish) Pathway ifu04382   Cornified envelope formation ifu05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ifu00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     128606997 (s100a10b)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     128606997 (s100a10b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ifu04147]     128606997 (s100a10b) Exosome [BR:ifu04147]  Exosomal proteins   Exosomal proteins of microglial cells    128606997 (s100a10b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 NNH2 DEK_C SPARC_Ca_bdg Motif Other DBs NCBI-GeneID:  128606997 NCBI-ProteinID:  XP_053479569 LinkDB All DBs Position 1:complement(8935917..8937944) Genome browser AA seq 98 aa AA seqDB search MPSDLERAMETLITVFHRYAGKEGNSTTLSRRELRQLMEAELANFLKAQKDPATVDKIMK DLDTNGDGEVSFEEFVSLVVGLSIACEQCYQMHLKGKK NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgccgtctgatctggagagagctatggaaacgctgatcacagtgttccatcgttatgca gggaaagaaggcaacagcaccactctgagccgccgagagctcaggcagctcatggaggca gagctcgctaacttccttaaggctcagaaagaccccgccaccgttgacaagattatgaaa gatctggacaccaatggggatggagaggtgagctttgaagagtttgtgtcccttgtcgtc ggtctgtccattgcctgtgaacagtgttaccagatgcaccttaaaggaaagaagtaa

DBGET integrated database retrieval system