Ictalurus furcatus (blue catfish): 128608137 Help Entry 128608137         CDS       T09387                                  Symbol nras Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism ifu  Ictalurus furcatus (blue catfish) Pathway ifu04010   MAPK signaling pathway ifu04012   ErbB signaling pathway ifu04068   FoxO signaling pathway ifu04137   Mitophagy - animal ifu04140   Autophagy - animal ifu04150   mTOR signaling pathway ifu04210   Apoptosis ifu04218   Cellular senescence ifu04370   VEGF signaling pathway ifu04371   Apelin signaling pathway ifu04540   Gap junction ifu04625   C-type lectin receptor signaling pathway ifu04810   Regulation of actin cytoskeleton ifu04910   Insulin signaling pathway ifu04912   GnRH signaling pathway ifu04916   Melanogenesis Brite KEGG Orthology (KO) [BR:ifu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     128608137 (nras)    04012 ErbB signaling pathway     128608137 (nras)    04370 VEGF signaling pathway     128608137 (nras)    04371 Apelin signaling pathway     128608137 (nras)    04068 FoxO signaling pathway     128608137 (nras)    04150 mTOR signaling pathway     128608137 (nras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     128608137 (nras)    04137 Mitophagy - animal     128608137 (nras)   09143 Cell growth and death    04210 Apoptosis     128608137 (nras)    04218 Cellular senescence     128608137 (nras)   09144 Cellular community - eukaryotes    04540 Gap junction     128608137 (nras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     128608137 (nras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     128608137 (nras)   09152 Endocrine system    04910 Insulin signaling pathway     128608137 (nras)    04912 GnRH signaling pathway     128608137 (nras)    04916 Melanogenesis     128608137 (nras)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ifu04131]     128608137 (nras)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ifu04147]     128608137 (nras)    04031 GTP-binding proteins [BR:ifu04031]     128608137 (nras) Membrane trafficking [BR:ifu04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     128608137 (nras)  Endocytosis   Macropinocytosis    Ras GTPases     128608137 (nras) Exosome [BR:ifu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    128608137 (nras)   Exosomal proteins of other body fluids (saliva and urine)    128608137 (nras)   Exosomal proteins of breast cancer cells    128608137 (nras)   Exosomal proteins of colorectal cancer cells    128608137 (nras) GTP-binding proteins [BR:ifu04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     128608137 (nras) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 ATP_bind_1 FeoB_N Septin Ldh_1_N AAA_16 Motif Other DBs NCBI-GeneID:  128608137 NCBI-ProteinID:  XP_053481589 LinkDB All DBs Position 5:28401176..28411728 Genome browser AA seq 188 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFADVHLYREQIKRVKDSDDVPMVLVGNKCDL ARTVDTKQAQELARSYGIEFVETSAKTRQGVEDAFYTLVREIRHYRMKKLNSREDRKQGC LGVSCEVM NT seq 567 nt NT seq  +upstreamnt  +downstreamnt atgaccgagtataagctggtggtggtgggagcaggtggtgtagggaagagtgcgcttacc atccagctcatccagaatcactttgtggacgaatatgaccccaccatagaggactcatac aggaagcaggtggtgatcgatggggagacatgtttgctggacatcctggacacagcagga caggaggagtacagtgccatgagagaccagtacatgaggactggcgagggcttcctctgc gtgttcgccatcaacaacaccaagtctttcgcagatgtacatttgtacagggagcagatc aagcgagtgaaggactctgacgacgtgcccatggtcctggttggaaacaaatgtgatttg gccagaactgtcgacaccaagcaggctcaggaactggccaggagctacggcattgaattt gtagaaacctcagccaagaccagacagggagttgaggatgctttttacaccttggtccgg gagatccgtcattatcgcatgaagaaactcaacagcagggaggacaggaaacagggttgt cttggagtctcctgcgaagtcatgtga

DBGET integrated database retrieval system