Ictalurus furcatus (blue catfish): 128610528 Help Entry 128610528         CDS       T09387                                  Name (RefSeq) C-C motif chemokine 4 homolog   KO K05408   C-C motif chemokine 3 Organism ifu  Ictalurus furcatus (blue catfish) Pathway ifu04060   Cytokine-cytokine receptor interaction ifu04620   Toll-like receptor signaling pathway Brite KEGG Orthology (KO) [BR:ifu00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     128610528  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     128610528  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ifu04052]     128610528    00536 Glycosaminoglycan binding proteins [BR:ifu00536]     128610528 Cytokines and neuropeptides [BR:ifu04052]  Cytokines   Chemokines    128610528 Glycosaminoglycan binding proteins [BR:ifu00536]  Heparan sulfate / Heparin   Chemokines    128610528 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  128610528 NCBI-ProteinID:  XP_053485878 LinkDB All DBs Position 7:complement(33030357..33033592) Genome browser AA seq 90 aa AA seqDB search MVSRSLLLVLLVLGCLQSFTAAHNGNGPDQCCFRYQTHRIPASHIKAYEETHHQCTNPGV ILDLKVGRHVCANPDEKWVQDTMKTIDQRA NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atggtctctcgttctctcctgctggttctgctggttctcggctgccttcagtccttcaca gcggctcataatggaaatggaccagatcagtgctgtttcagataccagacacatcgaatc cctgcatcccacattaaagcgtatgaagaaacacaccatcagtgtacaaatcctggagtc attttggatctaaaggtcggccgtcatgtgtgtgcgaaccccgatgaaaagtgggttcag gacaccatgaaaacaattgatcagcgagcctga

DBGET integrated database retrieval system