Ictalurus furcatus (blue catfish): 128613943 Help Entry 128613943         CDS       T09387                                  Symbol rheb Name (RefSeq) GTP-binding protein Rheb   KO K07208   Ras homolog enriched in brain Organism ifu  Ictalurus furcatus (blue catfish) Pathway ifu04140   Autophagy - animal ifu04150   mTOR signaling pathway ifu04218   Cellular senescence ifu04910   Insulin signaling pathway ifu05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:ifu00001]  09130 Environmental Information Processing   09132 Signal transduction    04150 mTOR signaling pathway     128613943 (rheb)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     128613943 (rheb)   09143 Cell growth and death    04218 Cellular senescence     128613943 (rheb)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     128613943 (rheb)  09160 Human Diseases   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     128613943 (rheb)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:ifu04031]     128613943 (rheb) GTP-binding proteins [BR:ifu04031]  Small (monomeric) G-proteins   Ras Family    Rheb     128613943 (rheb) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase RhoGAP_pG1_pG2 YebF ParE_toxin Reovirus_M2 AAA_14 Motif Other DBs NCBI-GeneID:  128613943 NCBI-ProteinID:  XP_053491117 LinkDB All DBs Position 1:27412963..27446789 Genome browser AA seq 184 aa AA seqDB search MPQPKSRKIAVLGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKMITVNGQEYHLQLVD TAGQDEYSIFPQTYSIDINGYILVYSVTSNKSFEVVKVIHEKLLDMVGKVQVPIMLVGNK KDLHMERVISCEEGKALAESWNAAFMESSAKENQTAVEVFKRIILEAEKMDGGAPQDRTP CSLM NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgccgcagcccaaatctcgaaaaatcgccgtgctgggttacagatccgtggggaagtcc tctttgacaatacagtttgttgaaggccagtttgtggactcgtacgacccgactatagaa aacacatttactaaaatgatcacagtcaatggccaagagtaccatctgcagctggtcgac acagcagggcaggatgagtactctattttccctcagacctattccatagacatcaacggt tacattttggtgtattctgttacatcaaataaaagttttgaagtagtaaaagttattcat gaaaaattgctggatatggtgggaaaagtacaagtaccaataatgctggtgggaaataaa aaagatctccatatggagcgtgttatcagctgtgaagaaggcaaagctttggcagaatca tggaacgcagcgttcatggagtcctctgcaaaagagaaccagactgcagtggaggtgttc aagaggataatcctggaggctgagaagatggatggcggagccccacaggaccggacaccc tgctcgctgatgtag

DBGET integrated database retrieval system