Ictalurus furcatus (blue catfish): 128614524 Help Entry 128614524         CDS       T09387                                  Symbol rhoca Name (RefSeq) ras homolog family member Ca   KO K04513   Ras homolog gene family, member A Organism ifu  Ictalurus furcatus (blue catfish) Pathway ifu04081   Hormone signaling ifu04144   Endocytosis ifu04150   mTOR signaling pathway ifu04270   Vascular smooth muscle contraction ifu04310   Wnt signaling pathway ifu04350   TGF-beta signaling pathway ifu04510   Focal adhesion ifu04520   Adherens junction ifu04530   Tight junction ifu04621   NOD-like receptor signaling pathway ifu04625   C-type lectin receptor signaling pathway ifu04810   Regulation of actin cytoskeleton ifu05100   Bacterial invasion of epithelial cells ifu05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ifu00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     128614524 (rhoca)    04350 TGF-beta signaling pathway     128614524 (rhoca)    04150 mTOR signaling pathway     128614524 (rhoca)   09133 Signaling molecules and interaction    04081 Hormone signaling     128614524 (rhoca)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     128614524 (rhoca)  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     128614524 (rhoca)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ifu04131]     128614524 (rhoca)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ifu04147]     128614524 (rhoca)    04031 GTP-binding proteins [BR:ifu04031]     128614524 (rhoca) Membrane trafficking [BR:ifu04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     128614524 (rhoca) Exosome [BR:ifu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    128614524 (rhoca)   Exosomal proteins of other body fluids (saliva and urine)    128614524 (rhoca)   Exosomal proteins of colorectal cancer cells    128614524 (rhoca)   Exosomal proteins of bladder cancer cells    128614524 (rhoca) GTP-binding proteins [BR:ifu04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     128614524 (rhoca) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  128614524 NCBI-ProteinID:  XP_053491853 LinkDB All DBs Position 11:complement(21631473..21651219) Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDDHTRRELAKMKQEPVKPEEGRDMANRISAFGYLECSAKTKDGVREVFEMATRAALQ VRKRKKRSGCLIL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggcagccataaggaaaaagctggtgatcgtgggagatggagcatgtggaaagacctgt ctactaatagtgttcagtaaagatcagttccccgaagtctacgtgccaactgtgttcgag aactacattgctgacattgaggtggatggcaaacaggtggagctggcactgtgggacaca gcaggtcaggaggactatgaccgattgagaccactttcctacccagatacagatgtcatc cttatgtgcttctccatcgacagtcctgacagtttagagaatattccagagaagtggacg ccagaggtgaaacacttttgccccaatgttcccattattttggtggggaataagaaagac ctgcggaatgatgaccacactcggagagagctggccaagatgaaacaggagcctgttaag ccagaggaaggccgcgacatggccaaccgtattagtgccttcggttacctggagtgctca gccaagaccaaggacggcgtgagggaagtgtttgaaatggccacaagggcagcgctgcaa gtccggaagaggaaaaagaggagtggctgcttgatcttgtga

DBGET integrated database retrieval system