Ictalurus furcatus (blue catfish): 128614749 Help Entry 128614749         CDS       T09387                                  Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism ifu  Ictalurus furcatus (blue catfish) Pathway ifu04137   Mitophagy - animal ifu04140   Autophagy - animal ifu04144   Endocytosis ifu04145   Phagosome ifu04148   Efferocytosis ifu05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ifu00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     128614749    04145 Phagosome     128614749    04140 Autophagy - animal     128614749    04137 Mitophagy - animal     128614749    04148 Efferocytosis     128614749  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     128614749  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ifu04131]     128614749   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ifu04147]     128614749    04031 GTP-binding proteins [BR:ifu04031]     128614749 Membrane trafficking [BR:ifu04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     128614749 Exosome [BR:ifu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    128614749   Exosomal proteins of other body fluids (saliva and urine)    128614749   Exosomal proteins of colorectal cancer cells    128614749   Exosomal proteins of bladder cancer cells    128614749 GTP-binding proteins [BR:ifu04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     128614749 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 Gtr1_RagA GTP_EFTU RsgA_GTPase ATP_bind_1 cobW nSTAND3 Septin PduV-EutP AAA_16 AAA_7 NTPase_1 AAA_22 AAA_24 FLYWCH_N SRPRB ATPase_2 AAA_5 NACHT NB-ARC AAA_14 ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  128614749 NCBI-ProteinID:  XP_053492314 LinkDB All DBs Position 11:25069315..25072470 Genome browser AA seq 207 aa AA seqDB search MASRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVEDRLVTLQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPTTFKTLDSWRDEFLIQASPRDPDNFPF LVLGNKIDLENRQVATKRAQAWCQSKNNMPYFETSAKEAISVEQAFQTIARNALKQETEV ELYNEFPDQIKLDRNDSSNSSAQSCTC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggcatccaggaagaaagttcttctaaaagtcatcatacttggggattctggtgttgga aagacatctttaatgaaccagtatgttaacaagaaattcagtaatcagtacaaagctaca ataggagctgactttcttacaaaggaggtgatggttgaagacagacttgttactttgcag atttgggacacagctggacaggaaaggtttcagtcactgggggtggcattttatcggggt gctgactgctgtgtgctggtgttcgatgttactgctccaaccacttttaagaccctggac tcctggagagatgagtttttgattcaggccagtcctcgtgacccagacaacttccctttc ctggtcctaggcaacaagatcgacttggaaaacaggcaggtggcaacaaagcgagcacag gcatggtgtcagagtaaaaacaacatgccatactttgagaccagtgcaaaagaggccatc agtgttgaacaggcatttcaaaccattgcacgaaatgctctaaaacaggaaacagaagtt gagctttataatgaatttccagatcagattaagttggacagaaatgacagctccaactca tcggcacaaagctgcacctgctaa

DBGET integrated database retrieval system