Ictalurus furcatus (blue catfish): 128614903
Help
Entry
128614903 CDS
T09387
Symbol
tspo
Name
(RefSeq) translocator protein
KO
K05770
translocator protein
Organism
ifu
Ictalurus furcatus (blue catfish)
Pathway
ifu04080
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:
ifu00001
]
09130 Environmental Information Processing
09133 Signaling molecules and interaction
04080 Neuroactive ligand-receptor interaction
128614903 (tspo)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
ifu02000
]
128614903 (tspo)
Transporters [BR:
ifu02000
]
Other transporters
Others
128614903 (tspo)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
TspO_MBR
Motif
Other DBs
NCBI-GeneID:
128614903
NCBI-ProteinID:
XP_053492581
LinkDB
All DBs
Position
11:25233209..25236153
Genome browser
AA seq
161 aa
AA seq
DB search
MWTAMLGLTALPHVGGIYGGLITRKEVKTWYASLNKPSWRPPNSAFGVVWTALYTGMGYG
SYLVYKELGGFTEDAVVPLGLYGLQLALNWAWTPIFFGAHKIKLAFIELVLLTGTVAATM
VSWYPVNRTATLLLTPYLAWLCLATSLNYCIWRDNPETKKD
NT seq
486 nt
NT seq
+upstream
nt +downstream
nt
atgtggacagccatgctgggtctgactgccttaccacatgttggtgggatctatggaggc
ttaatcacaagaaaagaggtgaagacgtggtacgcctcacttaacaaaccatcatggagg
ccacccaattcggcttttggagtggtatggaccgctttatacaccggcatggggtatggt
tcatacctggtatataaagagctcggaggcttcacagaagatgctgtggtcccactggga
ctctatggtctgcagctggcactgaactgggcctggacccctatcttttttggagcacac
aagatcaaactggcattcattgagcttgtcttgctgacaggcacagtggccgccaccatg
gtgtcctggtacccggtgaaccgcactgccacgctcctcctgactccatacctggcctgg
ctctgcttggctacctccctcaattactgcatctggagggacaaccctgagaccaaaaaa
gactag
DBGET
integrated database retrieval system