Ictalurus furcatus (blue catfish): 128615972 Help Entry 128615972         CDS       T09387                                  Symbol s100a10a Name (RefSeq) protein S100-A10a   KO K17274   protein S100-A10 Organism ifu  Ictalurus furcatus (blue catfish) Pathway ifu04382   Cornified envelope formation ifu05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ifu00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     128615972 (s100a10a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     128615972 (s100a10a)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ifu04147]     128615972 (s100a10a) Exosome [BR:ifu04147]  Exosomal proteins   Exosomal proteins of microglial cells    128615972 (s100a10a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EF-hand_5 EF-hand_6 EF-hand_8 DEK_C SPARC_Ca_bdg NNH2 Motif Other DBs NCBI-GeneID:  128615972 NCBI-ProteinID:  XP_053494374 LinkDB All DBs Position 12:complement(14974382..14976385) Genome browser AA seq 101 aa AA seqDB search MPSDLEKAMESLILVFHRYASREGNTNTLSRRELRELMENELSNFLRSQKDPGTVDKIMR DLDTNRDGEVSFEEFVSLVVGLSIACEQCYQLHLKKLGARK NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgccgtcggaccttgaaaaggctatggagtccctgattttggtgttccaccgctacgcg tccagagaggggaacaccaacactctgagccggcgtgagctcagggagctgatggagaac gagctctccaacttcctcaggtctcaaaaagaccctggtacagtggacaagatcatgagg gacctggacacaaatcgagacggagaagtgagctttgaggagtttgtgtctttagtggtt ggtctgtccattgcctgcgaacagtgttatcagttacatttgaagaagttaggagcccga aaatga

DBGET integrated database retrieval system