Ictalurus furcatus (blue catfish): 128617136 Help Entry 128617136         CDS       T09387                                  Name (RefSeq) elongin-B isoform X1   KO K03873   elongin-B Organism ifu  Ictalurus furcatus (blue catfish) Pathway ifu04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:ifu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     128617136  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ifu04121]     128617136    03400 DNA repair and recombination proteins [BR:ifu03400]     128617136 Ubiquitin system [BR:ifu04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      128617136    Cul5 complex      128617136 DNA repair and recombination proteins [BR:ifu03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      128617136 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  128617136 NCBI-ProteinID:  XP_053496120 LinkDB All DBs Position 13:complement(2350927..2355213) Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESTTVYELKRIVEGILKRPPEDQRLYKDDQLLDDGKTLGDS GFTNQTARPQAPATVGLAFRISDDAFEQLQVDPFSNPPELPDVMKPQDSGSTANEQSVQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggatgtgtttttaatgatccggcgtcataagacgaccatcttcacagacgcaaaggag tccacgactgtttacgagctgaaacgcattgttgagggcatcctgaagagaccgcctgag gaccagagactttacaaggatgatcagctgctagatgacggtaaaacactgggagattct ggtttcactaatcagacggccagacctcaggctcctgccacagtcggactcgccttccga attagcgacgatgcatttgagcagctccaagtggatccgttctcaaatccccccgagctt cctgacgtgatgaagcctcaggattcgggcagcacggccaatgagcagtcggtgcagtaa

DBGET integrated database retrieval system