Ictalurus furcatus (blue catfish): 128617417 Help Entry 128617417         CDS       T09387                                  Name (RefSeq) histone H2B-like   KO K11252   histone H2B Organism ifu  Ictalurus furcatus (blue catfish) Brite KEGG Orthology (KO) [BR:ifu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ifu03036]     128617417   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ifu04147]     128617417 Chromosome and associated proteins [BR:ifu03036]  Eukaryotic type   Nucleosome assembly factors    Histones     128617417 Exosome [BR:ifu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    128617417 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-GeneID:  128617417 NCBI-ProteinID:  XP_053496508 LinkDB All DBs Position 2:complement(17236589..17236928) Genome browser AA seq 86 aa AA seqDB search MPDPAKATPKKGSKKAVTKTAGKGGKKHRKSRKESYAIYVYKVLKQRSTVTFREIQTTIH LLLPGELSKHTASEGTKAVTKYTSSK NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgcccgatccagccaaggccacgcccaagaagggatctaagaaagctgtgaccaagaca gccggcaaaggaggcaagaagcacagaaagtccaggaaggagagctacgccatctacgtg tacaaggtcctgaagcagcgctccaccgtcaccttcagggagatccagaccaccatacac ctgttgcttcctggcgagctgtccaagcacactgcatccgagggcacaaaggccgtcacc aagtacaccagctccaagtaa

DBGET integrated database retrieval system