Ictalurus furcatus (blue catfish): 128618395 Help Entry 128618395         CDS       T09387                                  Symbol mycbp Name (RefSeq) C-Myc-binding protein isoform X1   KO K25550   c-Myc-binding protein Organism ifu  Ictalurus furcatus (blue catfish) Brite KEGG Orthology (KO) [BR:ifu00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:ifu03037]     128618395 (mycbp) Cilium and associated proteins [BR:ifu03037]  Motile cilia and associated proteins   Sperm associated proteins    128618395 (mycbp) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DUF2046 TSC22 HALZ HAP1_N K-box JIP_LZII Motif Other DBs NCBI-GeneID:  128618395 NCBI-ProteinID:  XP_053497946 LinkDB All DBs Position 14:31475256..31481381 Genome browser AA seq 108 aa AA seqDB search MAHYRASESKREQFRRYLEKAGVLDSLTNVLVALYEETEKPSNALDFIKQHLSAGDLDSS QAEVLRVELEELQHKYDLLQEENRELRNRPFFLWLFPMQSTLGHSWFG NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcacattacagagcctcggagtcaaagcgtgagcagttcaggaggtacctggagaag gccggggtactggacagtctgactaacgtgctggtggccttatatgaggagacggagaaa cccagcaacgccctggattttataaagcagcacctgtctgcaggagatctggactccagc caggccgaggttctccgagtggaactggaggaactacagcataaatatgacctgctacag gaggagaaccgtgagctcaggaaccggccctttttcctctggctgtttcccatgcaaagc actcttggtcactcctggtttggttga

DBGET integrated database retrieval system