Ictalurus furcatus (blue catfish): 128624678 Help Entry 128624678         CDS       T09387                                  Symbol rab7a Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism ifu  Ictalurus furcatus (blue catfish) Pathway ifu04137   Mitophagy - animal ifu04140   Autophagy - animal ifu04144   Endocytosis ifu04145   Phagosome ifu04148   Efferocytosis ifu05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ifu00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     128624678 (rab7a)    04145 Phagosome     128624678 (rab7a)    04140 Autophagy - animal     128624678 (rab7a)    04137 Mitophagy - animal     128624678 (rab7a)    04148 Efferocytosis     128624678 (rab7a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     128624678 (rab7a)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ifu04131]     128624678 (rab7a)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ifu04147]     128624678 (rab7a)    04031 GTP-binding proteins [BR:ifu04031]     128624678 (rab7a) Membrane trafficking [BR:ifu04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     128624678 (rab7a) Exosome [BR:ifu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    128624678 (rab7a)   Exosomal proteins of other body fluids (saliva and urine)    128624678 (rab7a)   Exosomal proteins of colorectal cancer cells    128624678 (rab7a)   Exosomal proteins of bladder cancer cells    128624678 (rab7a) GTP-binding proteins [BR:ifu04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     128624678 (rab7a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW PduV-EutP nSTAND3 Septin AAA_16 AAA_7 NTPase_1 AAA_22 AAA_24 G-alpha AAA_5 ATPase_2 NACHT NB-ARC AAA_14 SRPRB ABC_tran ATP-synt_ab Motif Other DBs NCBI-GeneID:  128624678 NCBI-ProteinID:  XP_053508313 LinkDB All DBs Position 21:18983440..18997119 Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDRNERAKPSAETCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacatcgaggaagaaagttctgctgaaagtgatcatcctcggggactcaggagtggga aagacctctctgatgaaccagtatgtgaacaagaagtttagcaatcagtacaaagctaca ataggagcggacttcctgacaaaagaggtgatggtggacgatcggcttgtcacaatgcag atttgggacacggcgggtcaggagcggttccagtctctgggcgtggcgttctaccgcggc gctgactgctgcgtgctcgtctttgacgtcacggcaccgaacaccttcaagacgctggac agctggagggacgagtttctgatccaggccagccctcgcgaccctgagaacttccccttc gtcgtgctcggcaacaaaatcgacctggagaacaggcaggtaaccactaagcgagcacaa gcctggtgccagagcaagaataacatcccctactttgagaccagcgccaaggaggccatc aacgtagagcaggctttccagaccatcgcacgcaacgcactcaaacaggaaaccgaggtg gagttgtacaacgagttcccagagccgatcaagctggacagaaacgagagagccaagcca tcagcggagacctgcagctgctga

DBGET integrated database retrieval system