Ictalurus furcatus (blue catfish): 128624763 Help Entry 128624763         CDS       T09387                                  Symbol brk1 Name (RefSeq) probable protein BRICK1   KO K05752   chromosome 3 open reading frame 10 Organism ifu  Ictalurus furcatus (blue catfish) Pathway ifu04810   Regulation of actin cytoskeleton ifu05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ifu00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     128624763 (brk1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     128624763 (brk1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CCDC53 Hydro_N_hd DUF7310 SPX Matrilin_ccoil MerR-DNA-bind DUF5617 LXG Motif Other DBs NCBI-GeneID:  128624763 NCBI-ProteinID:  XP_053508452 LinkDB All DBs Position 21:19366994..19369718 Genome browser AA seq 75 aa AA seqDB search MAGQEDPVQREIHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERR IEYIEARVTKGETLT NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggccggccaggaggatccagtgcagagagaaatccaccaggattgggcgaatcgcgag tatattgaagtgattacaagcagcatcaagaaaatagccgatttcctcaactcgtttgat atgtcctgcaggtcccgtttagccacgctgaacgagaagctcaccgccctggagagaagg atcgagtacatcgaagcccgggttacaaaaggggaaacgctgacctaa

DBGET integrated database retrieval system