Ictalurus furcatus (blue catfish): 128624840 Help Entry 128624840         CDS       T09387                                  Name (RefSeq) transforming protein RhoA-like   KO K04513   Ras homolog gene family, member A Organism ifu  Ictalurus furcatus (blue catfish) Pathway ifu04081   Hormone signaling ifu04144   Endocytosis ifu04150   mTOR signaling pathway ifu04270   Vascular smooth muscle contraction ifu04310   Wnt signaling pathway ifu04350   TGF-beta signaling pathway ifu04510   Focal adhesion ifu04517   IgSF CAM signaling ifu04519   Cadherin signaling ifu04520   Adherens junction ifu04530   Tight junction ifu04621   NOD-like receptor signaling pathway ifu04625   C-type lectin receptor signaling pathway ifu04810   Regulation of actin cytoskeleton ifu05100   Bacterial invasion of epithelial cells ifu05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ifu00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     128624840    04350 TGF-beta signaling pathway     128624840    04150 mTOR signaling pathway     128624840   09133 Signaling molecules and interaction    04081 Hormone signaling     128624840    04517 IgSF CAM signaling     128624840    04519 Cadherin signaling     128624840  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     128624840   09144 Cellular community - eukaryotes    04510 Focal adhesion     128624840    04520 Adherens junction     128624840    04530 Tight junction     128624840   09142 Cell motility    04810 Regulation of actin cytoskeleton     128624840  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     128624840    04625 C-type lectin receptor signaling pathway     128624840   09153 Circulatory system    04270 Vascular smooth muscle contraction     128624840  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     128624840    05100 Bacterial invasion of epithelial cells     128624840  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ifu04131]     128624840   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ifu04147]     128624840    04031 GTP-binding proteins [BR:ifu04031]     128624840 Membrane trafficking [BR:ifu04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     128624840 Exosome [BR:ifu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    128624840   Exosomal proteins of other body fluids (saliva and urine)    128624840   Exosomal proteins of colorectal cancer cells    128624840   Exosomal proteins of bladder cancer cells    128624840 GTP-binding proteins [BR:ifu04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     128624840 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  128624840 NCBI-ProteinID:  XP_053508604 LinkDB All DBs Position 21:20999115..21003877 Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDDHTRRELAKMKQEPVKAEEGRDMANRIYAFGYMECSAKTKDGVREVFEMATRAALQ ARKGKKGTKCLLL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggcagcgatccgtaagaagctggtgatcgtgggagatggtgcgtgcgggaagacgtgc ctcctcatcgtcttcagtaaggaccagttccccgaggtgtatgtccccaccgtgttcgaa aactacgtggccgacatcgaggtggacggaaaacaggtggagctggcactgtgggacacg gcaggacaagaagattacgatcgtctccgtcctctctcctaccccgacaccgacgtcatc ctcatgtgtttctccatcgacagtcctgacagtctcgagaacattccggaaaaatggact cccgaggtgaaacatttctgccccaacgtccccatcatcctggtgggcaacaagaaggac ctgcgcaacgacgaccacactcgccgcgagctagccaagatgaagcaggagccggtgaaa gcagaggagggccgcgacatggcaaatcggatctacgccttcggctacatggagtgttcg gccaagacgaaggatggtgtgcgggaggtgtttgagatggccaccagggcggccctgcag gccaggaaaggcaagaagggcaccaaatgcctcctactgtaa

DBGET integrated database retrieval system