Isoptericola halotolerans: UQW22_12935 Help Entry UQW22_12935       CDS       T11139                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism iha  Isoptericola halotolerans Pathway iha01100   Metabolic pathways iha01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:iha00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     UQW22_12935    00074 Mycolic acid biosynthesis     UQW22_12935   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     UQW22_12935 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 DacZ_P PP-binding_2 Motif Other DBs NCBI-ProteinID:  WTM15225 LinkDB All DBs Position complement(2799188..2799436) Genome browser AA seq 82 aa AA seqDB search MAHTASEILEGLAEIVAEETGLPTDAVVAEKSFTDDLDIDSLSMMTIVTHAEDKFGVRIP DDEVKNLATVGDAVKYIEGAQA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggctcacaccgcatccgagatcctcgagggcctcgcagagatcgtcgccgaggagacc ggtctgccgaccgacgccgtcgtcgccgagaagtccttcaccgacgacctcgacatcgac tcgctgtcgatgatgacgatcgtcacccacgccgaggacaagttcggcgtccgcatcccg gacgacgaggtcaagaacctcgccaccgtcggcgacgccgtgaagtacatcgagggtgcc caggcctga

DBGET integrated database retrieval system