Ignicoccus islandicus: EYM_07320 Help Entry EYM_07320         CDS       T04205                                  Name (GenBank) hypothetical protein   KO K11258   acetolactate synthase II small subunit [EC:2.2.1.6] Organism iis  Ignicoccus islandicus Pathway iis00290   Valine, leucine and isoleucine biosynthesis iis00650   Butanoate metabolism iis00660   C5-Branched dibasic acid metabolism iis00770   Pantothenate and CoA biosynthesis iis01100   Metabolic pathways iis01110   Biosynthesis of secondary metabolites iis01210   2-Oxocarboxylic acid metabolism iis01230   Biosynthesis of amino acids Brite KEGG Orthology (KO) [BR:iis00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     EYM_07320    00660 C5-Branched dibasic acid metabolism     EYM_07320   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     EYM_07320   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     EYM_07320 Enzymes [BR:iis01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      EYM_07320 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACT_5 DUF3970 Motif Other DBs NCBI-ProteinID:  ALU12769 UniProt:  A0A0U2WP93 LinkDB All DBs Position complement(1277917..1278219) Genome browser AA seq 100 aa AA seqDB search MSEHEAYVIKFSLYAAIDGGLDGLARAIHVVRKAPIRFHDMAVVDVGKTKEVSLRVSGKK KDIEWLAKKLEKVVEVLEVNVQPLPTEMVELIAHKERIRG NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgtcagagcacgaggcatacgtcataaagttctcgttatacgctgccattgatggaggt ctggacggccttgcaagagccatacatgtggtaaggaaagccccaatacgcttccacgac atggcagtggtagacgtgggtaagacaaaggaagtcagtctaagagtctctggtaagaaa aaggatattgagtggttagcgaagaaactagagaaagtagtagaagtattagaggtcaac gtccaacctctacccactgagatggttgagttaatagctcacaaagagagaatacgaggt tag

DBGET integrated database retrieval system