Ipomoea nil (Japanese morning glory): 109163183 Help Entry 109163183         CDS       T04663                                  Name (RefSeq) centromere protein S   KO K11511   centromere protein S Organism ini  Ipomoea nil (Japanese morning glory) Pathway ini03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:ini00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     109163183  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ini03036]     109163183    03400 DNA repair and recombination proteins [BR:ini03400]     109163183 Chromosome and associated proteins [BR:ini03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      109163183 DNA repair and recombination proteins [BR:ini03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      109163183 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-S CENP-T_C TFIID-31kDa Bromo_TP DUF1175 Motif Other DBs NCBI-GeneID:  109163183 NCBI-ProteinID:  XP_019167486 LinkDB All DBs Position Un AA seq 142 aa AA seqDB search MGGAEDVATASEVEREDDETSAAKELLRDRFRLCTISIAEAEAKQNDMEISQPIMACISD LAFKYAEQLAKDLELFSQHAGRKSVNMDDVILSTHRNEHLAASLRSFRDNLKAKEPQSDR KRKKRPTKEDRAAADELLVLDP NT seq 429 nt NT seq  +upstreamnt  +downstreamnt atgggaggagcggaagacgtagctacggcaagcgaagtagagcgagaggacgacgaaacc tccgccgccaaagagctcttgcgcgaccgatttcgcctctgcaccatctccatcgctgaa gccgaagcgaagcaaaatgatatggaaatttctcagccaattatggcttgtatctccgat ttagccttcaaatacgccgagcagctggcaaaggatctagagttattttcacagcatgct ggccgcaagtctgtgaatatggatgatgtcatactttcaacacaccggaatgagcatcta gctgcttcattgagatccttccgcgataatctgaaagcaaaagaaccccaatctgatagg aagaggaagaaaagaccaacaaaagaagacagagctgctgcagatgaactcttggtactg gatccataa

DBGET integrated database retrieval system