Ipomoea nil (Japanese morning glory): 109163196 Help Entry 109163196         CDS       T04663                                  Name (RefSeq) calmodulin   KO K02183   calmodulin Organism ini  Ipomoea nil (Japanese morning glory) Pathway ini04016   MAPK signaling pathway - plant ini04070   Phosphatidylinositol signaling system ini04075   Plant hormone signal transduction ini04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:ini00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     109163196    04070 Phosphatidylinositol signaling system     109163196    04075 Plant hormone signal transduction     109163196  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     109163196  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ini01009]     109163196   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ini04131]     109163196    03036 Chromosome and associated proteins [BR:ini03036]     109163196   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ini04147]     109163196 Protein phosphatases and associated proteins [BR:ini01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      109163196 Membrane trafficking [BR:ini04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     109163196 Chromosome and associated proteins [BR:ini03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      109163196 Exosome [BR:ini04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    109163196 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 AIF-1 EF-hand_9 EH SPARC_Ca_bdg EF_EFCAB10_C EF-hand_11 UPF0154 DUF5580_M Dockerin_1 Caleosin RNA_pol_Rpb4 EFhand_Ca_insen SPEF2_C FCaBP_EF-hand SurA_N_3 MotA_activ Fe_hyd_lg_C DUF6279 Motif Other DBs NCBI-GeneID:  109163196 NCBI-ProteinID:  XP_019167499 LinkDB All DBs Position Un AA seq 149 aa AA seqDB search MAEQLTEEQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADQ NGTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDE EVDEMIREADIDGDGQVNYEEFVRMMLAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcagagcagctaacggaggagcagatcgctgagttcaaggaagctttcagccttttc gacaaggacggcgatggctgtattactaccaaagagttgggaactgtgatgagatcactt ggtcaaaatcccactgaggctgaactacaagatatgatcaatgaagttgatgctgatcag aatggcacaattgattttcctgagtttttgaatctgatggcacggaaaatgaaggacact gattctgaggaggagctcaaggaagctttcaaagtattcgataaagatcagaacgggttc atttctgcagccgagctccgtcatgtgatgacaaacctgggggagaagctgacagacgaa gaggtggatgagatgatacgcgaagcagacatagatggcgatgggcaagttaattatgag gaatttgtacgcatgatgctggctaagtga

DBGET integrated database retrieval system