Ipomoea nil (Japanese morning glory): 109166096 Help Entry 109166096         CDS       T04663                                  Name (RefSeq) histone H2B-like   KO K11252   histone H2B Organism ini  Ipomoea nil (Japanese morning glory) Brite KEGG Orthology (KO) [BR:ini00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ini03036]     109166096   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ini04147]     109166096 Chromosome and associated proteins [BR:ini03036]  Eukaryotic type   Nucleosome assembly factors    Histones     109166096 Exosome [BR:ini04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    109166096 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone Motif Other DBs NCBI-GeneID:  109166096 NCBI-ProteinID:  XP_019170531 LinkDB All DBs Position Un AA seq 93 aa AA seqDB search MKPKAKKKLPKEGGFAEAGDKKKRVKKSSEMYKIYIFKKLAQEETRLARYNKNPTITSCE IQTGVRLVLPGELVKNVVSLKVLKQSPYLQALR NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgaagcccaaggccaagaagaagctccccaaggagggtggatttgcggaggccggagat aagaagaagagggtgaagaagtcatcggaaatgtacaagatctacatattcaagaaactc gcccaagaggagactcgcttggcccgctacaataaaaacccgaccatcacttcctgcgag atccagaccggcgtgagattggttcttcctggcgaattggtaaagaacgttgtctctctg aaagtactaaagcagtcaccatatttacaagctcttagataa

DBGET integrated database retrieval system