Ipomoea nil (Japanese morning glory): 109167134 Help Entry 109167134         CDS       T04663                                  Name (RefSeq) calmodulin-like   KO K02183   calmodulin Organism ini  Ipomoea nil (Japanese morning glory) Pathway ini04016   MAPK signaling pathway - plant ini04070   Phosphatidylinositol signaling system ini04075   Plant hormone signal transduction ini04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:ini00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     109167134    04070 Phosphatidylinositol signaling system     109167134    04075 Plant hormone signal transduction     109167134  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     109167134  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ini01009]     109167134   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ini04131]     109167134    03036 Chromosome and associated proteins [BR:ini03036]     109167134   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ini04147]     109167134 Protein phosphatases and associated proteins [BR:ini01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      109167134 Membrane trafficking [BR:ini04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     109167134 Chromosome and associated proteins [BR:ini03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      109167134 Exosome [BR:ini04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    109167134 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_9 AIF-1 EF-hand_FSTL1 SPARC_Ca_bdg Dockerin_1 SAPC2_N EH EF_EFCAB10_C EF-hand_EFHB_C DUF5580_M Fe_hyd_lg_C SPEF2_C TerB EF-hand_STIM1 RB_A EF-hand_SWAP70_N DUF7674 UPF0154 Ku_PK_bind Sigma54_CBD Motif Other DBs NCBI-GeneID:  109167134 NCBI-ProteinID:  XP_019171614 LinkDB All DBs Position Un AA seq 148 aa AA seqDB search MADALSQQQINEFREAFRLIDKDSDGVITLEELATIIQSLNVHPTKEEIQEMIREVDVNG DGSIDFQEFLNVMVRKIKENVSEELKEAFKVFDRDQDGFISAKELRNVMMNLGERLTEEE AKQMIKEADVDGVVSYEEFVRMMIIISY NT seq 447 nt NT seq  +upstreamnt  +downstreamnt atggctgatgcattgtcccaacaacagatcaacgaattccgggaagccttccgtctcatc gacaaagattccgatggggtgattactttggaagaactagcaacaataattcagtcttta aatgtgcatccgactaaagaagagattcaagaaatgataagagaggttgatgttaatgga gatgggagcatagattttcaggagtttttgaatgtcatggtcagaaagattaaggaaaac gtatcagaagagctcaaagaagcattcaaagtatttgatcgtgatcaagacggatttatc tctgccaaagagttaagaaatgtgatgatgaatttgggagaaagattgacagaagaggag gctaaacagatgatcaaagaggcagatgtagatggagttgttagctatgaagaatttgtg aggatgatgatcatcatttcttattga

DBGET integrated database retrieval system