Ilyobacter polytropus: Ilyop_1508 Help Entry Ilyop_1508        CDS       T01337                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ipo  Ilyobacter polytropus Pathway ipo01100   Metabolic pathways ipo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ipo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Ilyop_1508    00074 Mycolic acid biosynthesis     Ilyop_1508   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Ilyop_1508 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 DUF1493 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  ADO83288 UniProt:  E3H857 LinkDB All DBs Position complement(1624155..1624379) Genome browser AA seq 74 aa AA seqDB search MLDKIKEVVVDQLGVDADQVTLEANFVDDLGADSLDTVELIMAFEEEFDVEIPDTEAEKI KTVQDVVNYIESNK NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgttagataaaattaaagaagtagtagtagatcaattaggtgtagacgcggatcaagta actcttgaggcgaacttcgtagacgatttaggagcggattcactagatacagttgagcta attatggcttttgaagaagaatttgacgtagaaattcctgatacagaagctgaaaagatc aaaactgttcaagacgtagtaaactacatcgaatctaataagtaa

DBGET integrated database retrieval system