Ictalurus punctatus (channel catfish): 100305071 Help Entry 100305071         CDS       T04658                                  Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism ipu  Ictalurus punctatus (channel catfish) Pathway ipu04010   MAPK signaling pathway ipu04012   ErbB signaling pathway ipu04068   FoxO signaling pathway ipu04137   Mitophagy - animal ipu04140   Autophagy - animal ipu04150   mTOR signaling pathway ipu04210   Apoptosis ipu04218   Cellular senescence ipu04370   VEGF signaling pathway ipu04371   Apelin signaling pathway ipu04540   Gap junction ipu04625   C-type lectin receptor signaling pathway ipu04810   Regulation of actin cytoskeleton ipu04910   Insulin signaling pathway ipu04912   GnRH signaling pathway ipu04916   Melanogenesis Brite KEGG Orthology (KO) [BR:ipu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100305071    04012 ErbB signaling pathway     100305071    04370 VEGF signaling pathway     100305071    04371 Apelin signaling pathway     100305071    04068 FoxO signaling pathway     100305071    04150 mTOR signaling pathway     100305071  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100305071    04137 Mitophagy - animal     100305071   09143 Cell growth and death    04210 Apoptosis     100305071    04218 Cellular senescence     100305071   09144 Cellular community - eukaryotes    04540 Gap junction     100305071   09142 Cell motility    04810 Regulation of actin cytoskeleton     100305071  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     100305071   09152 Endocrine system    04910 Insulin signaling pathway     100305071    04912 GnRH signaling pathway     100305071    04916 Melanogenesis     100305071  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ipu04131]     100305071   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ipu04147]     100305071    04031 GTP-binding proteins [BR:ipu04031]     100305071 Membrane trafficking [BR:ipu04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     100305071  Endocytosis   Macropinocytosis    Ras GTPases     100305071 Exosome [BR:ipu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100305071   Exosomal proteins of other body fluids (saliva and urine)    100305071   Exosomal proteins of breast cancer cells    100305071   Exosomal proteins of colorectal cancer cells    100305071 GTP-binding proteins [BR:ipu04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     100305071 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 ATP_bind_1 FeoB_N Septin Ldh_1_N AAA_16 Motif Other DBs NCBI-GeneID:  100305071 NCBI-ProteinID:  XP_017323807 Ensembl:  ENSIPUG00000010414 UniProt:  W5UGF2 LinkDB All DBs Position 5:29532621..29543071 Genome browser AA seq 188 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFADVHLYREQIKRVKDSDDVPMVLVGNKCDL ARTVDTKQAQELARSYGIEFVETSAKTRQGVEDAFYTLVREIRHYRMKKLNSREDRKQGC LGVSCEVM NT seq 567 nt NT seq  +upstreamnt  +downstreamnt atgaccgagtataagctggtggtggtgggagcaggtggtgtagggaagagtgcgcttacc atccagctcatccagaatcactttgtggacgaatatgaccccaccatagaggactcatac aggaagcaggtggtgatcgatggggagacatgtttgctggacatcctggacacagcagga caggaggagtacagtgccatgagagaccagtacatgaggactggcgagggcttcctctgc gtgttcgccatcaacaacaccaagtctttcgcagatgtgcatttgtacagggagcagatc aagcgagtgaaggactctgatgacgtgcccatggtcctggttggaaacaaatgtgatttg gccagaactgtcgacaccaagcaggctcaggaactggccaggagctacggcattgaattt gtagaaacctcagccaagaccagacagggagttgaggatgctttttacaccttggtccgg gagatccgtcattatcgcatgaagaaactcaacagcagggaggacaggaaacagggttgt cttggagtctcctgcgaagtcatgtga

DBGET integrated database retrieval system