Ictalurus punctatus (channel catfish): 100528230 Help Entry 100528230         CDS       T04658                                  Symbol hrasa Name (RefSeq) HRas proto-oncogene, GTPase a   KO K02833   GTPase HRas Organism ipu  Ictalurus punctatus (channel catfish) Pathway ipu04010   MAPK signaling pathway ipu04012   ErbB signaling pathway ipu04068   FoxO signaling pathway ipu04137   Mitophagy - animal ipu04140   Autophagy - animal ipu04144   Endocytosis ipu04150   mTOR signaling pathway ipu04210   Apoptosis ipu04218   Cellular senescence ipu04370   VEGF signaling pathway ipu04371   Apelin signaling pathway ipu04510   Focal adhesion ipu04540   Gap junction ipu04625   C-type lectin receptor signaling pathway ipu04810   Regulation of actin cytoskeleton ipu04910   Insulin signaling pathway ipu04912   GnRH signaling pathway ipu04916   Melanogenesis ipu05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ipu00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     100528230 (hrasa)    04150 mTOR signaling pathway     100528230 (hrasa)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     100528230 (hrasa)    04140 Autophagy - animal     100528230 (hrasa)    04137 Mitophagy - animal     100528230 (hrasa)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ipu04131]     100528230 (hrasa)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ipu04147]     100528230 (hrasa)    04031 GTP-binding proteins [BR:ipu04031]     100528230 (hrasa) Membrane trafficking [BR:ipu04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     100528230 (hrasa)  Endocytosis   Macropinocytosis    Ras GTPases     100528230 (hrasa) Exosome [BR:ipu04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    100528230 (hrasa)   Exosomal proteins of colorectal cancer cells    100528230 (hrasa) GTP-binding proteins [BR:ipu04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     100528230 (hrasa) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin G-alpha Ldh_1_N AAA_16 CbiA Motif Other DBs NCBI-GeneID:  100528230 NCBI-ProteinID:  NP_001187429 Ensembl:  ENSIPUG00000006053 UniProt:  E3TE95 LinkDB All DBs Position 14:10825198..10843077 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTADTRQAHELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGQD CMSCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaagctggtggtggtgggagctggaggcgttggcaagagtgctcttacc atccaactcatccagaaccactttgtggatgaatatgaccctaccatagaggactcgtac aggaagcaggtggtgatcgacggtgagacatgcctgttggacattctggacacagcaggt caagaggagtacagtgccatgagggaccagtacatgaggacaggagagggcttcctctgt gtctttgccatcaataacaccaagtcgtttgaggacattcatcagtacagggaacagatc aaacgggtaaaggactcggatgatgtgccaatggtgcttgtgggtaataaatgtgacctc ccagctcgcacagcggacacacggcaagcgcatgagcttgctcgaagctacggcatcccc tacatcgagacctcagccaagactagacaaggagtggaggatgccttctacacactagta cgggagatccgacagcacaagttgaggaagctcaatcctccagatgaaagcggacaggac tgcatgagctgtcgctgcgtggtgtcatga

DBGET integrated database retrieval system