Ictalurus punctatus (channel catfish): 100528348 Help Entry 100528348         CDS       T04658                                  Symbol s100a10b Name (RefSeq) protein S100-A10b   KO K17274   protein S100-A10 Organism ipu  Ictalurus punctatus (channel catfish) Pathway ipu04382   Cornified envelope formation ipu05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ipu00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     100528348 (s100a10b)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100528348 (s100a10b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ipu04147]     100528348 (s100a10b) Exosome [BR:ipu04147]  Exosomal proteins   Exosomal proteins of microglial cells    100528348 (s100a10b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 NNH2 DEK_C SPARC_Ca_bdg Motif Other DBs NCBI-GeneID:  100528348 NCBI-ProteinID:  NP_001187547 Ensembl:  ENSIPUG00000003482 UniProt:  E3TER0 LinkDB All DBs Position 1:complement(8541542..8543429) Genome browser AA seq 98 aa AA seqDB search MPSDLERAMETLITVFHRYAGKEGNSTTLSRRELRQLMEAELANFLKAQKDPATVDKIMK DLDTNGDGEVSFEEFVSLVVGLSIACEQCYQMHLKGKK NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgccgtctgatctggagagagctatggaaacactgatcacagtgttccatcgttatgca gggaaagaaggcaacagcaccactctgagccgccgagagctcaggcagctcatggaggca gagctcgctaacttccttaaggctcagaaagaccctgcgaccgttgacaagattatgaaa gatctggacacgaatggggatggagaggtgagctttgaagagtttgtgtcccttgtcgtc ggtctgtccattgcctgtgaacagtgttaccagatgcaccttaaaggaaagaagtaa

DBGET integrated database retrieval system