Ictalurus punctatus (channel catfish): 100528356 Help Entry 100528356         CDS       T04658                                  Symbol brk1 Name (RefSeq) probable protein BRICK1   KO K05752   chromosome 3 open reading frame 10 Organism ipu  Ictalurus punctatus (channel catfish) Pathway ipu04810   Regulation of actin cytoskeleton ipu05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ipu00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     100528356 (brk1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100528356 (brk1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CCDC53 Hydro_N_hd DUF7310 SPX Matrilin_ccoil MerR-DNA-bind DUF5617 LXG Motif Other DBs NCBI-GeneID:  100528356 NCBI-ProteinID:  NP_001187555 UniProt:  E3TES3 LinkDB All DBs Position 21:19038823..19040802 Genome browser AA seq 75 aa AA seqDB search MAGQEDPVQREIHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERR IEYIEARVTKGETLT NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggccggccaggaggatccagtgcagagagaaatccaccaggattgggcgaatcgcgag tatattgaagtgattacaagcagcatcaagaaaatagccgatttcctcaactcgtttgat atgtcctgcaggtcccgtttagccacgctgaacgagaagctcaccgccctggagagaagg atcgagtacatcgaagcccgggttacaaaaggggaaacgctgacctaa

DBGET integrated database retrieval system