Ictalurus punctatus (channel catfish): 108254710 Help Entry 108254710         CDS       T04658                                  Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism ipu  Ictalurus punctatus (channel catfish) Pathway ipu04144   Endocytosis ipu04150   mTOR signaling pathway ipu04270   Vascular smooth muscle contraction ipu04310   Wnt signaling pathway ipu04350   TGF-beta signaling pathway ipu04510   Focal adhesion ipu04520   Adherens junction ipu04530   Tight junction ipu04621   NOD-like receptor signaling pathway ipu04625   C-type lectin receptor signaling pathway ipu04810   Regulation of actin cytoskeleton ipu05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ipu00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     108254710    04350 TGF-beta signaling pathway     108254710    04150 mTOR signaling pathway     108254710  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     108254710   09144 Cellular community - eukaryotes    04510 Focal adhesion     108254710    04520 Adherens junction     108254710    04530 Tight junction     108254710   09142 Cell motility    04810 Regulation of actin cytoskeleton     108254710  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     108254710    04625 C-type lectin receptor signaling pathway     108254710   09153 Circulatory system    04270 Vascular smooth muscle contraction     108254710  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     108254710  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ipu04131]     108254710   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ipu04147]     108254710    04031 GTP-binding proteins [BR:ipu04031]     108254710 Membrane trafficking [BR:ipu04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     108254710 Exosome [BR:ipu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    108254710   Exosomal proteins of other body fluids (saliva and urine)    108254710   Exosomal proteins of colorectal cancer cells    108254710   Exosomal proteins of bladder cancer cells    108254710 GTP-binding proteins [BR:ipu04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     108254710 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  108254710 NCBI-ProteinID:  XP_017305449 Ensembl:  ENSIPUG00000018464 UniProt:  A0A2D0PHZ6 LinkDB All DBs Position 21:20676818..20682049 Genome browser AA seq 231 aa AA seqDB search MRSANRAGARGTDSCAVVLDALGGRDRKNSLAKHQTQEMAAIRKKLVIVGDGACGKTCLL IVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILM CFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKAE EGRDMANRIYAFGYMECSAKTKDGVREVFEMATRAALQARKGKKGTKCLLL NT seq 696 nt NT seq  +upstreamnt  +downstreamnt atgcgcagtgctaatcgggcaggagctcgcggtactgacagttgcgccgttgtgcttgac gctttgggtgggagagaccggaaaaactcgctcgctaagcatcaaacacaagaaatggca gcgatccgtaagaagctggtgatcgtgggagacggtgcgtgcgggaagacgtgcctcctc atcgtcttcagtaaggaccagttccccgaggtgtatgtccccaccgtgttcgaaaactac gtggccgacatcgaggtggacggaaaacaggtggagctggcgctgtgggacacggcagga caagaagattacgatcgtctccgtcctctctcctaccctgacaccgacgtcatcctcatg tgtttctccatcgacagtcctgacagtctcgagaacattccggaaaaatggactcccgag gtgaaacatttctgccccaacgtccccatcatcctggtgggcaacaagaaggacttgcgc aacgacgaacacactcgccgcgagctagccaagatgaagcaggagccggtgaaagcagag gagggccgtgacatggcaaatcggatctacgccttcggctacatggagtgttcggccaag acgaaggatggtgtgcgggaggtgttcgagatggccaccagggcggccctgcaggccagg aaaggcaagaagggcaccaaatgcctcctactgtaa

DBGET integrated database retrieval system