Ictalurus punctatus (channel catfish): 108259964 Help Entry 108259964         CDS       T04658                                  Name (RefSeq) insulin   KO K04526   insulin Organism ipu  Ictalurus punctatus (channel catfish) Pathway ipu04010   MAPK signaling pathway ipu04068   FoxO signaling pathway ipu04081   Hormone signaling ipu04114   Oocyte meiosis ipu04140   Autophagy - animal ipu04150   mTOR signaling pathway ipu04810   Regulation of actin cytoskeleton ipu04910   Insulin signaling pathway ipu04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:ipu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     108259964    04068 FoxO signaling pathway     108259964    04150 mTOR signaling pathway     108259964   09133 Signaling molecules and interaction    04081 Hormone signaling     108259964  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     108259964   09143 Cell growth and death    04114 Oocyte meiosis     108259964   09142 Cell motility    04810 Regulation of actin cytoskeleton     108259964  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     108259964    04914 Progesterone-mediated oocyte maturation     108259964  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ipu04052]     108259964 Cytokines and neuropeptides [BR:ipu04052]  Neuropeptides   Unclassified    108259964 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  108259964 NCBI-ProteinID:  XP_017315312 Ensembl:  ENSIPUG00000022501 UniProt:  A0A2D0QAI1 LinkDB All DBs Position 28:3391797..3393023 Genome browser AA seq 108 aa AA seqDB search MAIWLQGGVLLFLLAFYSGGVNAVAPQHLCGSHLVEALYLVCGPNGFFYNPKREVDPLLG FLPPKSAPEGELAEYPYKEYSELMVKRGIVELCCHKPCSLQDLQNYCN NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcaatttggctccagggtggtgttctgctgttcttgctggcattctacagtggagga gtcaatgctgtggcaccccaacacctgtgtggttctcacctggttgaagccctgtaccta gtctgtggtccgaacgggttcttctacaaccctaaaagagaggtggatcctctgctgggg ttccttcccccgaaatctgctccggagggcgagctggctgaatacccctataaagagtac agtgagctgatggtgaagagaggcattgtggagctgtgctgccataaaccctgcagctta caagacctgcaaaactactgcaactga

DBGET integrated database retrieval system