Ictalurus punctatus (channel catfish): 108260679 Help Entry 108260679         CDS       T04658                                  Symbol cxcl8a Name (RefSeq) C-X-C motif chemokine 2   KO K10030   interleukin 8 Organism ipu  Ictalurus punctatus (channel catfish) Pathway ipu04060   Cytokine-cytokine receptor interaction ipu04218   Cellular senescence ipu04620   Toll-like receptor signaling pathway ipu04621   NOD-like receptor signaling pathway ipu04622   RIG-I-like receptor signaling pathway ipu05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ipu00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     108260679 (cxcl8a)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     108260679 (cxcl8a)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     108260679 (cxcl8a)    04621 NOD-like receptor signaling pathway     108260679 (cxcl8a)    04622 RIG-I-like receptor signaling pathway     108260679 (cxcl8a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     108260679 (cxcl8a)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ipu04052]     108260679 (cxcl8a)    00536 Glycosaminoglycan binding proteins [BR:ipu00536]     108260679 (cxcl8a) Cytokines and neuropeptides [BR:ipu04052]  Cytokines   Chemokines    108260679 (cxcl8a) Glycosaminoglycan binding proteins [BR:ipu00536]  Heparan sulfate / Heparin   Chemokines    108260679 (cxcl8a) SSDB OrthologParalogGFIT Motif Pfam:  IL8 Fungus-induced Motif Other DBs NCBI-GeneID:  108260679 NCBI-ProteinID:  XP_017316606 UniProt:  A0A2D0QFV5 LinkDB All DBs Position 29:complement(33291..34410) Genome browser AA seq 91 aa AA seqDB search MNCRTVFVFVLLAFITLTAGMSVEPRCRCSGLESRRVGKLIEHVELFPPNPHCTHTEIIA TLKGSSQQICLDTKAPWVVKVIAKIMANHSP NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaactgcaggacggtttttgtctttgtgctcctggccttcatcaccctgacagcagga atgagtgttgagccacggtgtcgctgtagtgggcttgagagtcgtcgtgttgggaaactg atcgaacacgttgaactttttcctcccaacccacactgcacacacactgagatcatagcc acacttaagggcagcagtcagcagatctgtctggacactaaagcaccatgggtagttaag gtgattgcgaagatcatggcaaaccattcgccctga

DBGET integrated database retrieval system