Ictalurus punctatus (channel catfish): 108261728 Help Entry 108261728         CDS       T04658                                  Name (RefSeq) histone H3   KO K11253   histone H3 Organism ipu  Ictalurus punctatus (channel catfish) Brite KEGG Orthology (KO) [BR:ipu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ipu03036]     108261728   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ipu04147]     108261728 Chromosome and associated proteins [BR:ipu03036]  Eukaryotic type   Nucleosome assembly factors    Histones     108261728 Exosome [BR:ipu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    108261728 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C CENP-S CBFD_NFYB_HMF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  108261728 NCBI-ProteinID:  XP_017318021 UniProt:  A0A2D0QHE9 A0A2D0QJI8 LinkDB All DBs Position Unknown AA seq 97 aa AA seqDB search HRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEA YLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA NT seq 294 nt NT seq  +upstreamnt  +downstreamnt catcgttacaggcctggcactgtggctctgagagagatccgccgttatcagaagtctact gagctgctcatccgcaagctgcccttccagcgcctggtgagagaaatcgctcaggacttc aagaccgacttgcgtttccagagctcggccgtcatggctctgcaggaggcaagcgaggca tacctggtcggtctgttcgaggacaccaacctgtgcgctatccacgccaagagagtgacc atcatgcccaaggatattcagttggcccgccgtattcgcggagaacgcgcttaa

DBGET integrated database retrieval system