Ictalurus punctatus (channel catfish): 108271788 Help Entry 108271788         CDS       T04658                                  Symbol rhoca Name (RefSeq) ras homolog family member Ca   KO K04513   Ras homolog gene family, member A Organism ipu  Ictalurus punctatus (channel catfish) Pathway ipu04081   Hormone signaling ipu04144   Endocytosis ipu04150   mTOR signaling pathway ipu04270   Vascular smooth muscle contraction ipu04310   Wnt signaling pathway ipu04350   TGF-beta signaling pathway ipu04510   Focal adhesion ipu04520   Adherens junction ipu04530   Tight junction ipu04621   NOD-like receptor signaling pathway ipu04625   C-type lectin receptor signaling pathway ipu04810   Regulation of actin cytoskeleton ipu05100   Bacterial invasion of epithelial cells ipu05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ipu00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     108271788 (rhoca)    04350 TGF-beta signaling pathway     108271788 (rhoca)    04150 mTOR signaling pathway     108271788 (rhoca)   09133 Signaling molecules and interaction    04081 Hormone signaling     108271788 (rhoca)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     108271788 (rhoca)   09144 Cellular community - eukaryotes    04510 Focal adhesion     108271788 (rhoca)    04520 Adherens junction     108271788 (rhoca)    04530 Tight junction     108271788 (rhoca)   09142 Cell motility    04810 Regulation of actin cytoskeleton     108271788 (rhoca)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     108271788 (rhoca)    04625 C-type lectin receptor signaling pathway     108271788 (rhoca)   09153 Circulatory system    04270 Vascular smooth muscle contraction     108271788 (rhoca)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     108271788 (rhoca)    05100 Bacterial invasion of epithelial cells     108271788 (rhoca)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ipu04131]     108271788 (rhoca)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ipu04147]     108271788 (rhoca)    04031 GTP-binding proteins [BR:ipu04031]     108271788 (rhoca) Membrane trafficking [BR:ipu04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     108271788 (rhoca) Exosome [BR:ipu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    108271788 (rhoca)   Exosomal proteins of other body fluids (saliva and urine)    108271788 (rhoca)   Exosomal proteins of colorectal cancer cells    108271788 (rhoca)   Exosomal proteins of bladder cancer cells    108271788 (rhoca) GTP-binding proteins [BR:ipu04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     108271788 (rhoca) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  108271788 NCBI-ProteinID:  XP_017335049 Ensembl:  ENSIPUG00000023572 UniProt:  W5U9P7 LinkDB All DBs Position 11:complement(9862879..9882560) Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDDHTRRELAKMKQEPVKPEEGRDMANRISAFGYLECSAKTKDGVREVFEMATRAALQ VRKRKKRSGCLIL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggcagccataaggaaaaagctggtgatcgtgggagacggagcatgtggaaagacctgt ctactaatagtgttcagtaaagatcagttccctgaagtctacgtgccaactgtgtttgag aactacattgctgacattgaggtggatggcaaacaggtggagctggcactgtgggacaca gcaggtcaggaggactatgaccgattgagaccactttcctacccagatacagatgtcatc cttatgtgcttctccatcgacagtcctgacagtttagagaatattccagagaagtggacg ccagaggtgaaacacttttgccccaatgttccaattattttggtggggaataagaaagac ctgcggaatgatgaccacactcggagagagctggccaagatgaaacaggagcctgttaag ccagaggaaggccgtgacatggccaaccgtattagtgccttcggttacctggagtgctca gccaagaccaaggatggtgtgagggaagtgtttgaaatggccacaagggcagcgctgcaa gtccggaagaggaaaaagaggagtggctgcttgatcttgtga

DBGET integrated database retrieval system