Ictalurus punctatus (channel catfish): 108271868 Help Entry 108271868         CDS       T04658                                  Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism ipu  Ictalurus punctatus (channel catfish) Pathway ipu04137   Mitophagy - animal ipu04140   Autophagy - animal ipu04144   Endocytosis ipu04145   Phagosome ipu04148   Efferocytosis ipu05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ipu00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     108271868    04145 Phagosome     108271868    04140 Autophagy - animal     108271868    04137 Mitophagy - animal     108271868    04148 Efferocytosis     108271868  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     108271868  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ipu04131]     108271868   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ipu04147]     108271868    04031 GTP-binding proteins [BR:ipu04031]     108271868 Membrane trafficking [BR:ipu04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     108271868 Exosome [BR:ipu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    108271868   Exosomal proteins of other body fluids (saliva and urine)    108271868   Exosomal proteins of colorectal cancer cells    108271868   Exosomal proteins of bladder cancer cells    108271868 GTP-binding proteins [BR:ipu04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     108271868 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 Gtr1_RagA GTP_EFTU RsgA_GTPase ATP_bind_1 cobW nSTAND3 Septin PduV-EutP AAA_16 AAA_7 NTPase_1 AAA_22 AAA_24 FLYWCH_N SRPRB ATPase_2 AAA_5 G-alpha NACHT NB-ARC AAA_14 ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  108271868 NCBI-ProteinID:  XP_017335236 Ensembl:  ENSIPUG00000017200 UniProt:  A0A2D0RYI4 LinkDB All DBs Position 11:13263908..13267200 Genome browser AA seq 207 aa AA seqDB search MASRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVEDRLVTLQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPTTFKTLDSWRDEFLIQASPRDPDNFPF LVLGNKIDLENRQVATKRAQAWCQSKNNMPYFETSAKEAISVEQAFQTIARNALKQETEV ELYNEFPDQIKLDRNDSSSSSAQSCGC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggcatccaggaagaaagttcttctaaaagtcatcatacttggggattcaggtgttgga aagacatctttaatgaaccagtatgttaacaagaaattcagtaatcagtacaaagctaca ataggagctgactttcttacaaaggaggtgatggttgaagacagacttgttactttgcag atttgggacacagctggacaggaaaggtttcagtcactgggcgtggcattttatcggggt gctgactgctgtgtgctggtgttcgatgttactgctccaaccacatttaagaccctggac tcctggagagatgagtttttgattcaggccagtcctcgtgacccagacaacttccctttc ctggtcctaggcaacaagatcgacctggaaaacaggcaggtggcaacaaagcgagcacag gcatggtgtcagagtaaaaacaacatgccatactttgagaccagtgcaaaagaggccatc agtgttgaacaggcatttcaaaccattgcacgaaatgctctaaaacaggaaacagaagtt gagctttataatgaatttccagatcagattaagttggacagaaatgacagctccagctca tcggcacaaagctgcggctgctaa

DBGET integrated database retrieval system