Ictalurus punctatus (channel catfish): 108277449 Help Entry 108277449         CDS       T04658                                  Symbol dynll2a Name (RefSeq) dynein, light chain, LC8-type 2a   KO K10418   dynein light chain LC8-type Organism ipu  Ictalurus punctatus (channel catfish) Pathway ipu04517   IgSF CAM signaling ipu04814   Motor proteins ipu05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ipu00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     108277449 (dynll2a)  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     108277449 (dynll2a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     108277449 (dynll2a)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:ipu03037]     108277449 (dynll2a)    04812 Cytoskeleton proteins [BR:ipu04812]     108277449 (dynll2a) Cilium and associated proteins [BR:ipu03037]  Motile cilia and associated proteins   Dynein arm    108277449 (dynll2a) Cytoskeleton proteins [BR:ipu04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      108277449 (dynll2a) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Nop SpoIIIAH Ectatomin Motif Other DBs NCBI-GeneID:  108277449 NCBI-ProteinID:  XP_017345704 Ensembl:  ENSIPUG00000017060 UniProt:  A0A2D0SSN4 LinkDB All DBs Position 17:complement(5404184..5407351) Genome browser AA seq 89 aa AA seqDB search MTDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGR NFGSYVTHETKHFIYFYLGQVAILLFKSG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgactgacaggaaagctgtgatcaagaatgctgacatgtctgaggacatgcagcaggat gcagttgactgtgcaactcaggccatggagaagtacaacattgagaaggacatcgcagca tacatcaaaaaggagtttgacaagaagtacaacccaacatggcactgcatcgtaggaaga aactttggcagctacgtcacccacgagacgaagcacttcatctacttctacttgggccag gtggcgatcctcctgttcaaatccggctga

DBGET integrated database retrieval system